Q4LDE5 identified as Pentraxin in LectomeXplore
Q4LDE5
Redundant proteins identified: KAI2553521.1 KAI4008049.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LKAFTLCLRAYSELSRAYSL-FSYATK-RRDNELLVYKEKVIEYSLTVGRSKVLSKVIEKTV-APVHICVSWESASGIVEFWVDGKPL-VKKSLKKGYTVEAEAKIVLGQEQDSYGGKFERSQSLVGEIGDLYMWDSVLSPEEILSIYLGTP--L-SANVLDWRALKYEVRGEVII
PREDICTED: LHALTCTFWMKSSDDMNYGTPISYAVDNGSDNTLLLT--DYNGWVLYVNGREKITNCPSVNDGRWHHIAITWTSANGIWKVYIDGKLSDGGAGLSVGLPIPGGGALVLGQEQDKKGEGFSPAESFVGSISQLNLWDYVLSPQQVKSLATSCPEELSKGNVLAWPDFLSGIVGKVKI
View sequence for Pentraxin 1448 : 1621View gene sequenceView neighboring sequences
Cite How to cite