O94813 identified as Laminin G-like in LectomeXplore
O94813
Redundant proteins identified: 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: DDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTMIPT-KINDGQWHKIKIVRVKQEGILYVDDASSQTISP-KKADILDVVGILYVGGLP--INYTTRRIGP--VTYSLDGCVRNLHMEQAPVD
PREDICTED: PSAKVRPQTNITLQIATDEDSGILLYKGDK---DHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITNLSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQD
View sequence for Laminin G-like 1174 : 1319View gene sequenceView neighboring sequences
Cite How to cite