P98161 identified as C-type lectin in LectomeXplore
P98161
Redundant proteins identified: KAI2576493.1 EAW85553.1 AAC50128.1 KAI4052901.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LKKEVEKLKS--CPKKWKAFQ--GKCYFFSNEKKTWEEAEKACSE-RGAHLVVIKSAEEQEFLQ-QLSKSNSYWIGLTDEKTEGTWQWVDGSPLNY---KNWAPGEPNNAGNEDCVEIKANGW-NDVKCEKKKLAICEKEAAS
PREDICTED: LGEEPARAVHPLCPSDTEIFPGNGHCYRLVVEKAAWLQAQEQCQAWAGAALAMVDSPAVQRFLVSRVTRSLDVWIGFSTVQGVEVGPAPQGEAFSLESCQNWLPGEPHPATAEHCVRLGPTGWCNTDLCSAPHSYVCELQPGG
View sequence for C-type lectin 394 : 536View gene sequenceView neighboring sequences
Cite How to cite