Q7Z442 identified as C-type lectin in LectomeXplore
Q7Z442
Redundant proteins identified: AAO32796.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: EVEKLKSCPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ-QLSKSNSYWIGLT-----DEKTEGTWQWVDGSPLNYKNWAPGEPNNAGNEDCVEIKANG---WNDVKCEKKKLAICEKEAASC
PREDICTED: EEGSF--CSNSQVAFRDACYEFVPLGRTFRDAQSWCEGQGGHLVFIQDEGTQWFLQKHISQDREWWIGLTWNLARNGTTEGPGTWLDTSNVTYSNWHGGQAAAAP-DTCGHIGRGPSSEWVTSDCAQTFAFMCEFRVGQS
View sequence for C-type lectin 23 : 159View sequence for L-rhamnose binding lectin 159 : 269View gene sequenceView neighboring sequences
Cite How to cite