P16112 identified as C-type lectin in LectomeXplore
P16112
Redundant proteins identified: A0A5K1VW97 NP_001398026.1 XP_047288171.1 XP_047288170.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KLKS--CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNN--AGNEDCV--EIKANG-WNDVKCEKKKLAICEKEAASCSK
PREDICTED: NIDQEVCEEGWNKYQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQ-WIGLNDRTIEGDFRWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTVACGE
View sequence for C-type lectin 2314 : 2449View gene sequenceView neighboring sequences
Cite How to cite