O15394 identified as I-type lectin in LectomeXplore
O15394
Redundant proteins identified: AAB80803.1 KAI2595804.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KNCTLLLSDLRKEDKGKYFF--RVE-RG--SYKQTKLSVEVLDLVNKPNIVVPEEVVAGTEVEVSCSVPDNCEELRPELSWLG-GRL-REDEGTTVQVSLLHLVPTR--EANGTRLGCQAAFPNATLQFEGYVSLDVKYPPVIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMR--DGMVL
PREDICTED: ANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAISMPQKSFNATAERGEEMTFSCRASGS---PEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYVCRATN--KAGEDEKQAFLQVFVQPHIIQLKNET-TYENGQVTLVCDAEGEPIPEITWKRAVDGFTF
View sequence for I-type lectin 76 : 150View sequence for I-type lectin 167 : 343View sequence for I-type lectin 362 : 482View gene sequenceView neighboring sequences
How to cite: François Bonnardel, Julien Mariethoz, Serge Pérez, Anne Imberty, Frédérique Lisacek, LectomeXplore, an update of UniLectin for the discovery of carbohydrate-binding proteins based on a new lectin classification, Nucleic Acids Research doi.org/10.1093/nar/gkaa1019