O00182 identified as galectin-like in LectomeXplore
O00182
Redundant proteins identified: A0A024QZ55 KAI2581945.1 
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
View sequence for galectin-like 2 : 156View sequence for galectin-like 217 : 354View gene sequenceView neighboring sequences
REFERENCE: SLSSSGSPIYNLPVPYLVTLNAGLKPGSLVTIKGSV-ASNAKRFAVNLGTGSS--DIALHFNPRFDENG-IVCNSKENGSWGQEEREKAFPFQKGKEFEITILVDPDKFKVKVNGKHVLEYPHRLKLEAVSYLQVEGDIQLTSVSVSGLKLLAAA
PREDICTED: AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQ
Cite How to cite