P32004 identified as I-type lectin in LectomeXplore
P32004
Redundant proteins identified: Q7Z3Z9 A8K139 BAF82443.1 CAA42508.1 BAC81122.1 
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
View sequence for I-type lectin 144 : 324View sequence for I-type lectin 346 : 465View sequence for I-type lectin 479 : 556View gene sequenceView neighboring sequences
REFERENCE: VPEEVVAGTEVEVSCSVPDNCEELRPELSWLG---GRLREDE-GTTVQVSLLHLVPT-REANGTRLGCQAAFPNAT-LQFEGYVSLDVKYPPVIVE--------MNSS--VEAIEGSHVSLLCGADSNPPPLLTWMRD-GMVLREAVA---KSLYLDLEEVTPGEDGVYACLAENAYGQDNRT
PREDICTED: KPVEVEEGESVVLPCNPPPSAEPL--RIYWMNSKILHIKQDERVTMGQNGNLYFANVLTSDNHSDYICHAHFPGTRTIIQKEPIDLRVKATNSMIDRKPRLLFPTNSSSHLVALQGQPLVLECIAEGFPTPTIKWLRPSGPMPADRVTYQNHNKTLQLLKVGEEDDGEYRCLAENSLGSARHA
Cite How to cite