Q5H8C1 identified as C-type lectin in LectomeXplore
Q5H8C1
Redundant proteins identified: BAD89015.1 KAI2552156.1 KAI4006688.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: VEKLKS--CPKKWKAFQGKCYFFSN-EKKTWEEAEKACSERG-AHLVVIKSAEEQEFLQQLSKSNSYWIGLTDEKTEGTWQWVDGSPLNYKNWAPGEPNNAGN--EDCVEIKANG-WNDVKCEKK--KLAICEK
PREDICTED: TKDVEDKSCPAGWHQHSGYCHILITEQKGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRG-PSQRSKLGKSCVLVQRQGKWQTKDCRRAKPHNYVCSR
View sequence for C-type lectin 2045 : 2177View gene sequenceView neighboring sequences
Cite How to cite