Q9NPY3 identified as C-type lectin in LectomeXplore
Q9NPY3
Redundant proteins identified: Q8IXK1 CAC82720.1 AAB53110.1 EAX10171.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: QGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ------------QLSKSNSYWIGLTDEKT--------EGTWQWVDGSPLNY-KNWAPGEPNNAGNEDCV----E
PREDICTED: GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLD
View sequence for C-type lectin 33 : 147View gene sequenceView neighboring sequences
Cite How to cite