Q9HAR2 identified as L-rhamnose binding lectin in LectomeXplore
Q9HAR2
Redundant proteins identified: 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: LTCEGKDLELECDGAK-ISVKRANYGRRDDDIC--PDKQLEDTNCLASSSLKILAERCDGRSECVVVASNDVFGDPCVGTYKYLEVKYSCVAYKVE
PREDICTED: LSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDPAQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVPYKVE
View sequence for L-rhamnose binding lectin 34 : 129View gene sequenceView neighboring sequences
Cite How to cite